SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00822.1|PACid:22049785 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00822.1|PACid:22049785
Domain Number 1 Region: 1-142
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.35e-16
Family Ribosomal protein L14e 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00822.1|PACid:22049785
Sequence length 142
Sequence
MKFLKPNKAVIVLQGRHAGRKAVIVRSYDEGTRDRPYGHCLVAGISKYPKKVIRKDSEKK
TAKKSRVKAFVKLVNYNHIMPTRYTLDVDFKDVVSGSSSSNAATELFQSRDNKVTASKQI
KARFEERFKTGKNRWFFSKLRF
Download sequence
Identical sequences A0A2G5F0R9
Aquca_003_00822.1|PACid:22049785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]