SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00851.2|PACid:22050479 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00851.2|PACid:22050479
Domain Number 1 Region: 12-100
Classification Level Classification E-value
Superfamily POZ domain 1.15e-17
Family Tetramerization domain of potassium channels 0.0044
Further Details:      
 
Domain Number 2 Region: 124-315
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000942
Family Quinoprotein alcohol dehydrogenase-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00851.2|PACid:22050479
Sequence length 470
Sequence
MEELNSHSQRQDRIKLNVGGKLFETTISTLLSAGPDSLLAALSARERDNENPVFIDRDPE
IFSVLLYLLRTSHLPSTARRFSKQELTEEALYYGVESQFKAAILPPPLSGIDASLIETIR
PASDGFPTAFTAGAGDGSVWIAHGGQISGYDWNLLHAGTIRTHLDSITSIRRVWPEVAAV
GSDTAAGLHLYDFSSGRRIGSAQWTDSSDPRIYKARVLSITDSSTSVFASFDCAHKENCI
LQIDKSTLKITSEIGRLPGNSTKTVVPKKLAYLPESGIIFSSAVSSGAFGYSGFIRLWDP
RTGEMVWETNEPGSGRSSRFGDSFADVDVEVEESTMFKVCSKSGDVGMADLRNLKDDPWI
YLDEKNPSLRNTGGEENNVIHCYRKQVFVSRETGLEVWSHVEHIEEDVESRDFEKRCYRR
NYVDKVEHCREKGMIRRMEGGGDRLFVSREGVEGLEVWESSDLSGAVSFL
Download sequence
Identical sequences A0A2G5F0U5
Aquca_003_00851.1|PACid:22050480 Aquca_003_00851.2|PACid:22050479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]