SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00899.1|PACid:22049393 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00899.1|PACid:22049393
Domain Number 1 Region: 135-273
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.23e-38
Family B3 DNA binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 615-694
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000608
Family PB1 domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00899.1|PACid:22049393
Sequence length 711
Sequence
MGSNGVTEGMKVEGLSSKMKGTSSCFDESLINQGEKDSLYAELWQLCAGPLVTVPRLGEK
VYYFPQGHLEQVEAYTSQEANVKMPKYDLPSKILCTVVHIELMAEFDTDEVFAQVTLLPE
TQHKEPTMEKERPQLQPQKSRIYTFSKALTASDTSTHGGFSVLKKHADDCLPPLDLSQQP
PTQELIAKDLHGIEWRFRHIYRGQPKRHLLTSGWSTFVSAKKLVTGDAFIFLRGENGELR
VGVRRAMKPNNNASPSVLSNHSMQLGVLASASHAISTGSMFSVYYRPRTSPSEFIVPYSQ
YVKSTQTSYTVGTRFRMKFETEESPERRLAGTVVGNEDFDPLRWPGSEWRCLKVQWDETF
ANVVRPDRVSPWKIEPVPVPSHLPQPKKARIRLLSSPSETSVLLTDGFQQGANNPSPQLQ
RQSGVFQGQENNVISGHEFGIKGKPPLTHLLVPTPNLSWGHENELNYQMHDLFSPGLGNL
TPNSSVIPDVLGCRTYCLPPLSTIGVDGADEIHEMWSSSNAISYMAPEPKEVVNTPTAQS
KSSGTCIIFGVDFIKNPLESVPSCDTSTDVVAPVTSQLAVVASDRLLDLNQSMKPSSYSS
FGCISEELDKTNVFNSRSCTKVHKYGTALGRSVDLMRFNGYDELINELDQMFDFGGQLMD
YSKSWSVVYTDGEGNTKLIGDYPWQKFQSMVQKMYIYPKEEVDNLTAHINW
Download sequence
Identical sequences A0A2G5F116
Aquca_003_00899.1|PACid:22049393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]