SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_004_00100.2|PACid:22030143 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_004_00100.2|PACid:22030143
Domain Number - Region: 317-473
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 0.000177
Family Lysine biosynthesis enzyme LysX ATP-binding domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_004_00100.2|PACid:22030143
Sequence length 498
Sequence
MGISVRGILLDESVLFVEESNGNTFFQSGAEPLLRRLQYSNIQTGISHGLGVSAQKTTFL
QSIAMLYSLDSFMLNTSSIDVSLSEILLAWGDIGGRCLYVTSSLNEDGLCHKLMNQDWLI
VIIGAQGVGVMENSKVIFINSLEELPLAICRFNKKVSDENVLTVGYVMKPSREEDFAKRG
AFPLHPTQNCLMFVPLTFNLPLASQLREVDVVLHKATDEVVSIGLSDSSECATKTFYTKG
MQELERYFQDHHDCCVIDPLDNISSVLDRLKMQQILLGLEDLKADGCCRIRAPHFLKVDD
FNDPNLGKRLSEVGLFLPSIVKPQVACGVADAHDMAIVFRTEDFKSLQVPLPVVVQEYVD
HSSLLYKFYVLGEKVFFAIKNSTPNADVFLSSYEKDGHKPIIFNSLKSLPTSKVAVNSKF
SEQFLDLELVKDAAKWLRDILNLTIFGFDVVIQEGSRDHVVVDVNYLPSFKEVPDEVAIP
AFWDAIKNAHELRRANPT
Download sequence
Identical sequences A0A2G5ETI6
Aquca_004_00100.2|PACid:22030143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]