SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_004_00155.2|PACid:22029725 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_004_00155.2|PACid:22029725
Domain Number 1 Region: 13-94
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.89e-18
Family B3 DNA binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_004_00155.2|PACid:22029725
Sequence length 266
Sequence
MKRNKFFRIIGGKDCQLELPSEFVEEHGNQLSDGLVLKVRTGDTWNIGLRKFAGRIVFNG
GWKEFAHHYSLDAGYCLFFTYSGNSRFDVVIMDPGDAEIIYPSKVVKFKEPKTMVPMAKN
NGTEKKFVKKLSITCNKDNLRESVLFAGKQHQGKQIFELGEPSFCRMVEDVATNEVHAAK
PSFLQTKEKNGGVSTVMAFMSNHPFFKLNVSSAYHKHRHMVSYLPKDLNIIKNLLKLFFI
YRRLFFLLFFFAVFSTLLPRVSCTRI
Download sequence
Identical sequences A0A2G5ETP7
Aquca_004_00155.2|PACid:22029725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]