SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_004_00201.1|PACid:22030297 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_004_00201.1|PACid:22030297
Domain Number 1 Region: 9-396
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.81e-118
Family Motor proteins 0.0000000126
Further Details:      
 
Weak hits

Sequence:  Aquca_004_00201.1|PACid:22030297
Domain Number - Region: 402-508
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000523
Family Myosin rod fragments 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_004_00201.1|PACid:22030297
Sequence length 1006
Sequence
MSRVDKGVNVQVLLRCRPFSDDELRSNAPQVVTCNDYQREVAVSQNIAGKQIDRVFTFDK
VFGPSAQQRDLYDQAVVPIVNEVLEGFNCTIFAYGQTGTGKTYTMEGECKKSKSGSKGQL
PPEAGVIPRAVKQIFDTLESQNAEYSVKVTFIELYNEEITDLLAPEELSKVSSEEKQKKQ
LLLMEDGKGGVLVRGIEEEIVTSASEIFTLLERGSSKRRTAETLLNKQSSRSHSLFSITI
HIKESTPEGEELIKCGKLNLVDLAGSENISRSGAREGRAREAGEINKSLLTLGRVISALV
EHLGHVPYRDSKLTRLLRDSLGGRTKTCIIATVSPAVHCLEETLSTLDYAHRAKNIRNKP
EVNQKMMKSTLIKDLYGEIDRLKAEVYAAREKSGVYIPKERYYQEESERKAMADQIEQMS
VTLESNQRQIEELQEKYDAQVLESSDLSCKLDDTEIRLEQTSKLLAKVEEQLRKSQYTVK
EKDFIISELRKAENALAHQACVLRSDLEKSHKDNASLFSKLAREDKLNSENRSVVDDFQA
SLTQKIGTLCTTVATSMSQQHGHLECVEKLCHSFLEIHEKLVSDLKKKMAASRALFTSHM
EAMQNVVRLHKASNNAGLDEISSLALANASAVKLHLATMDGEASSVFADLQATLSSQQGE
MALFARELREKFNVSVEHTKETSNYINDLLNKLGEESHRLQTQTSRVHNVQQKNIAEFQK
SYEELTKSESEKLCADLFNLVSVHFNRQKELVDLKLNGLKDTASENKAILDEHTSLMGGI
TSDAKRKWQEFSSHAENSARDSADYSAAKHCRMEVFLQKCVTTVDTASEHWQKTHESVND
MSSEHASAIGLHARNVCESNELHDLEIVSTRTAAEEDVAKNNEDILHHFENVSQQERESI
SSIMGVVEAQTSTLQKLRDDHSGGAMEIEQQAQSTFQDRYMDYEPSGTTPTRSDVDVPSK
GTIESLRTMPLDSLLEEFRENHPYEASNVKEIKPSLIPRSPLLQLN
Download sequence
Identical sequences A0A2G5ETW3
Aquca_004_00201.1|PACid:22030297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]