SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_004_00240.1|PACid:22029886 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_004_00240.1|PACid:22029886
Domain Number 1 Region: 19-139
Classification Level Classification E-value
Superfamily PH domain-like 1.43e-46
Family Dcp1 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_004_00240.1|PACid:22029886
Sequence length 371
Sequence
MAQSGKLMPNLDQQSTKQLNLTVLQRIDPFVEEILITAAHVTFYEFNIELNQWSRKDVEG
SLFVVKRNTQPRFQFIVMNRRNTDNLVENLLGDFEYEVQVPYLLYRNAAQEVNGIWFYNS
RECEDVANLFSRILNAYSKVPPKLKVSSNKSEFEELEAVPTMDVMEGPLEPTSSNASAVV
DSPDDSTFVNFFSAAMNIGNTSNAVIPGQQIQAPAMLSLSSHAPSIAPSPVPSLQKPPPL
PISSSPMMPLPDTSDLNCNNHAANLVKPSSFFVPPPSSSVLMVPQVSSSTPSSIPSAPPL
HPPVNLQRPYGTPMLQPFPPPTPSPSLTPAPAQNYVPIITKDKVRETLMRVFQKDEFIEM
FYQELLNVHYS
Download sequence
Identical sequences A0A2G5EU17
Aquca_004_00240.1|PACid:22029886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]