SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_004_00265.1|PACid:22030777 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_004_00265.1|PACid:22030777
Domain Number - Region: 76-103
Classification Level Classification E-value
Superfamily WW domain 0.00102
Family WW domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_004_00265.1|PACid:22030777
Sequence length 218
Sequence
MALDVQHKQQNHHVLGCVVGAHHHTTHDTITSSSSISSSVFNFDLNLSHLHKPSFVPITL
DLFHIENPSSIVELDEPSPLPFGWQKCLNLKTGEIYYTKEKRRKKATIMSRNGKNPRLDL
KLNLSPPRANQQVVESPNRSAVSSPTSPPSSCVSSELNNDETLRYSNSPEATSMVLVGCP
RCLMYVMLSEEDPKCPKCKSTVLLDFVHDNNTKKTKKN
Download sequence
Identical sequences A0A2G5EU25
Aquca_004_00265.1|PACid:22030777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]