SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_004_00380.1|PACid:22029564 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_004_00380.1|PACid:22029564
Domain Number 1 Region: 44-220,248-292,508-576
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.96e-28
Family WD40-repeat 0.042
Further Details:      
 
Domain Number 2 Region: 493-716,777-798
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000366
Family WD40-repeat 0.017
Further Details:      
 
Domain Number 3 Region: 1044-1096
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.000000131
Family SNARE fusion complex 0.0045
Further Details:      
 
Weak hits

Sequence:  Aquca_004_00380.1|PACid:22029564
Domain Number - Region: 214-416
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.051
Family Quinohemoprotein amine dehydrogenase B chain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_004_00380.1|PACid:22029564
Sequence length 1105
Sequence
MFAKRLFEKVTNLSPPSLSSSSSQHAKFGSVAPTDLDLRVPLHYGIPSTASVLAFDPIQR
LMAVGTLDGRIKVIGGDNIEGLLISPKQLPYKYLEFLHNTSFLVGVSNENNIQVWDLEHR
RIACSFPWDSNITAFSPIHGTNFMYVGDEWGLMSVLKYDAEEGKLLQLPYHIPSYSLCES
AGVSISSHQSIVGLLPQPRAFESRVLIAYEKGLIILWDISEAQAVLVRSYKDLQLRNAIV
VGPSKGLRSEIAVTLDHEQEDKEISSLCWASSDGSILAVGYVDGDIMLWNMSLTSSSKGQ
QTGISSNNVVKLQLSSGEKRLPVIVLRWSACSRSENESGGQLFIYGGNEIGSEEVLTVLS
LEWSSGIDKLQCVSRVDLTFDGSFSDLILVKNSGPMKNPGDTLFVLTNPGQIHVYDDPIL
AGLWSQHEEKASISAIRFPVVVPTVDPYITVTKLCLIPIGGSLSNLLLEMASVMKIGATV
TLTTGSKWPLTGGVLGQSFSDDYVVERLYMAGYQDGSVRIWDATSPTLSLICAIESEVET
IEVAGTSASVSAVDFFPLTASLAVGNECGLVRVYKLSQSPGETDIHFMTETKHEVHQKHQ
GKGLQCRAIFSLLSSPVQILQYANNGAKLAVGFGCGRVGMLDMNSLSVLFLTDSISSSSS
PVISLTEKASLDIYNIISPNEESMNPKDPADVLFILTRDLNLLIVDSVTGNLIGSRQMKQ
TEDSTAVAMYIIESSILVSETVRGKHPEQLSQNSLTQDEPVQANNLSGDTPHEVDPNTCS
ENITSGESSLDSLILVCCNNALGLFSLKSVLKGDYNSICKVNLARPCCWTTTFKSKDEKV
CGLAIFYHTGVVEIRSLPDLEVVRESSIMSILRWSFKANMDRTICSSDTGQISLVNGGEL
AFISLLSCEIDFRIPKSLPSLHDKVLQAGSDAANNLSANQKKKEAPTSGIIDGIINGIKG
GKVGGVVDLVQQLDIIFSKAPFQEALELNIDDIEIDEPVFVTSTASDQGSKDRKDKETER
EKLFEGVTVDTKPRLRKPEEVIAKYRKAGDASAAASQARDKLIERQEKLERLSRNTEELQ
DGAQNFASMAKELVKTMEGRKWWQI
Download sequence
Identical sequences A0A2G5EUN0
Aquca_004_00380.1|PACid:22029564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]