SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_004_00409.1|PACid:22029680 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_004_00409.1|PACid:22029680
Domain Number 1 Region: 33-160
Classification Level Classification E-value
Superfamily PH domain-like 1.5e-43
Family Ran-binding domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_004_00409.1|PACid:22029680
Sequence length 249
Sequence
MASSTNESERRVVEEEEETTHVEDEDTGAQVAPIVRLEEVAVSTGEENELVLLDLKSKLY
RFDKEGNQWKERGAGTVKILKHKTNGKIRLVMRQSKTLKICANHLILPGMAVQEHSGNEK
SCVWHATDFSDEELKQEFFCIRFGSVENCKAFMRKFEEVADIAETEGKEGDETAELLENQ
LKIEDGKAKDGGEEVPVAAVDNQPEVERSVTEKVHVAAVENQPKVEDSSTEEVPKEEVVE
KPDQSEKKV
Download sequence
Identical sequences A0A2G5EUV3
Aquca_004_00409.1|PACid:22029680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]