SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_004_00456.2|PACid:22029696 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_004_00456.2|PACid:22029696
Domain Number 1 Region: 519-643
Classification Level Classification E-value
Superfamily BRCA2 helical domain 2.09e-36
Family BRCA2 helical domain 0.00065
Further Details:      
 
Domain Number 2 Region: 644-785
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.46e-32
Family Single strand DNA-binding domain, SSB 0.00018
Further Details:      
 
Domain Number 3 Region: 787-816,935-1020
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.91e-25
Family Single strand DNA-binding domain, SSB 0.0073
Further Details:      
 
Domain Number 4 Region: 817-935
Classification Level Classification E-value
Superfamily BRCA2 tower domain 2.35e-17
Family BRCA2 tower domain 0.0037
Further Details:      
 
Domain Number 5 Region: 1024-1181
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000142
Family Single strand DNA-binding domain, SSB 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_004_00456.2|PACid:22029696
Sequence length 1184
Sequence
MPTWQIFSDAGNTYRWVSYGQASMNSVEAQSHKTLINCENPTSRLPSIEDLLIQGSSKLL
PNCGAMYDEKAPLFRTGSGKSVEVKQSSITKAMSVLNEGDVSDTGSLRVLQNCCNVHVEK
SSMFRTGSGKPVEVKQASVLKALSVLGEDDVTDRGCSKILQDFGGVHDEKSAMFRTGSGK
SVEVKQSSIMKALTVLGTDDVTSRGQMCATTSGRGFSNSLFQTASGKTVNLSPASLVRAE
ALLGLEESSVQKIADKSNGWENSSNQKKGGRRHINATVASRPISEYPVSGQTDVYAMGCE
SRELLPDFLASEMLKSTGKPPPIKFQTAGGKSISISDNAMQRAKSLLGDSEFGNSSNKGG
ADGQFHSPLKENRLSGTSFNQENAIFASRLEHIPAKRKSNSKSFFPPKAPIFKENKGSTA
IEAFVSAQTIGPRTNPLGRSSCGPLVDISNSIGTAYADQNKIPHEKRRFGKLSSVSPFKK
PRNSRFSTPLTSNISLLPYGTTTLTSREPCSKEKIFARYPFQVARATVKDFFGGPPHQTY
QSKHISPEVKCMNGETAEIYTFHEASHLDGIGADAFRHMLAQSGVSMQYATREWVANHYK
WIVWKLACYERGYPAKTIGKYLTVSNVLEELKYRYEREVNHAHRSALKRILEGDASPASM
VVLCISAIRSNLDDRLDLEPAVAIYEDTNKLSGAKMADNSKVAKIELTDGWYAIDAILDV
PLSKQLVAKKLFIGQKLRIWRAGLCGWVAPTSPLESSRTVSLQLNMNGTYRAHWADKLGL
CRGPATPLAFSCIKSDGGVVPKTLVGITRIYPILYKESLADGGSLVRSERMERKIQQVYN
QKRSTIAEGLVSEFQKDVSSFSSKNENDSHEGAELLKILEKSAEPELVMAELSTNQLTSF
ANYQAKQAEIRQSDMEKKIEKALKEAGLSERHVKPFMRVRVVGLTSNHSPRKNCHREGLI
TIWNPTEKQQLELVEGHAYTVAGLIPLNSDSETIYLHARGSTTTWQTLPSSAIASFDPFF
TPRKPVFLSNMGELPLASEFDIAALVVYVGDVYLSGHHKKQWVFVTDGSIAVSELESKDV
SNCLLAISICTPTADNDSFAPISSTLAGSTIGFINLVKRAHDPMNHLWVAEATDNSTYSF
RYDIPGYYHLKEVAGSACKWAKMSSLAIQKLKEKILFIVGNGKS
Download sequence
Identical sequences A0A2G5EUZ0
Aquca_004_00456.2|PACid:22029696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]