SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_004_00463.3|PACid:22030192 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_004_00463.3|PACid:22030192
Domain Number 1 Region: 205-275
Classification Level Classification E-value
Superfamily Single hybrid motif 0.0000000000667
Family Biotinyl/lipoyl-carrier proteins and domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_004_00463.3|PACid:22030192
Sequence length 284
Sequence
MDSAAVLRSFHCSVGTVSHVQSTIEKTGMIPMCNVTLKKSSFSQGLSGRGRLFSPVIRKG
AFVSCVKASETPIAATLEASLDSNSQGSTEKKNGLTAMFPSGFEELVLEVCDETDVAELK
LKIGDFEMNLKRNIGATTSPAPVVSHSVPAVSESAPASSSSSPTPSQSSPEKTSPFKNVS
SEKSLKLASLEASGSTGYVIVSSPSVGSFLTGRIVKEKKQPPLCKVGDIIKEGQIIGYLD
QFGSELPVRSDVSGEVLKMLYSDGEAVGYGDPLMAVLPSFHGIR
Download sequence
Identical sequences A0A2G5EV24
Aquca_004_00463.3|PACid:22030192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]