SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_004_00472.1|PACid:22030318 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_004_00472.1|PACid:22030318
Domain Number 1 Region: 79-205
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.4e-26
Family D-Alanine ligase N-terminal domain 0.0064
Further Details:      
 
Domain Number 2 Region: 492-569,619-671
Classification Level Classification E-value
Superfamily PreATP-grasp domain 8.25e-24
Family D-Alanine ligase N-terminal domain 0.0034
Further Details:      
 
Domain Number 3 Region: 206-463
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 4.12e-22
Family ATP-binding domain of peptide synthetases 0.027
Further Details:      
 
Domain Number 4 Region: 721-752,799-921
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 0.00000000000000159
Family ATP-binding domain of peptide synthetases 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_004_00472.1|PACid:22030318
Sequence length 949
Sequence
MASLSSSIHNITTYRFASQNKSFVSTTNFSKKLIWKKNLLYKKQQQRCAESGLISKASSI
DVIDDQIVENEVEEENRVLRVGLICGGPSAERGISLNSARSVLDHIQGDDLDVRCYYIDC
NLDAFAISSAQVYSNTPADFDFKLESLAQSFQSLSEFTEHLASSVDIVFPVIHGRFGEDG
GIQELLEKANIPFVGTPSVECSRAFDKFEASMELKKQGFVTIPNFLVQGRSSSKSDLFKW
FERNQIDSNVGKVVVKPARAGSSIGVTVAYGVDDAIKKANNIISEGIDDKVVIEIFLEGG
SEFTAIVLDIGSGFDFHPVVLLPTEVELHFHGSKDVKEDDAIFNYRRKYLPTQQVAYHTP
PRFPTDVIEHIRRGASLLFQRFGLRDFARIDGWFLPSSVHISSSTDKVNEFGRSKSGTIL
FTDINLISGMEQTSFLFQQASKVGFSHSNILRTIIQRACLRFPVLAPYSNASGALSTRLK
STPAISKSKGAKKVFVIFGGETSERQVSLMSGTNVWLNLQAFDDLEVTPCLLSPPNGYSS
NENKEYDVLSKKVWSLPYSLVLRHTTEEVLAACLEAIEPARATLTSHLRNQVMVDLEGLS
KHSWFTGFDISDVPPVKYSLEQWIKHVKEVQGTVFIAVHGGIGEDGTIQSLLEAEGVPYT
GPGVIASKTCMDKVATSLALSHLENLGVLTIHKDVRSKGELLSMPILDIWLDLTEKLQCE
TLCIKPARDGCSTGVARLRSSEDLAVYANALRNCLLRLPPNSLSKAHGVIEMPNPPPELL
IFEPFVETDDIIVSSKSTNENSHHLIWKGHSRWVEVTVGVIGQRGAMRSLSPSVTVKESG
DILSLEEKFQGGTGINLTPPPSSIISMEALKRCKDRIEIIANTLGLEGFSRIDAFVNVDS
GEVLIIEVNTVPGMTPSTVLIHQALSEQPPMYPQEFFRTLLDLASDRSK
Download sequence
Identical sequences A0A2G5EVB2
Aquca_004_00472.1|PACid:22030318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]