SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aquca_004_00548.1|PACid:22029528 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_004_00548.1|PACid:22029528
Domain Number - Region: 53-82
Classification Level Classification E-value
Superfamily HIT-like 0.00312
Family HIT (HINT, histidine triad) family of protein kinase-interacting proteins 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_004_00548.1|PACid:22029528
Sequence length 116
Sequence
MVKQLVLQTCKVFITPKPTNSTFFFKNPTSHFSSSVNHPTKIMASNSYKFGPYKISEKEV
FYTTQLSYAMVNLRPLVPGHILYIDVCHLFWGIHFEIYVHGKDINPSNKHFDIHAT
Download sequence
Identical sequences A0A2G5EVI4
Aquca_004_00548.1|PACid:22029528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]