SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_004_00805.1|PACid:22030341 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_004_00805.1|PACid:22030341
Domain Number 1 Region: 182-375
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.67e-33
Family BCR-homology GTPase activation domain (BH-domain) 0.0011
Further Details:      
 
Domain Number 2 Region: 7-136
Classification Level Classification E-value
Superfamily PH domain-like 8.77e-19
Family Pleckstrin-homology domain (PH domain) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_004_00805.1|PACid:22030341
Sequence length 887
Sequence
MSGSFGPLEGPRNGVSGSNTVYKSGPLLISSKGIGWKSWKKRWFILTRTSLVFFKNDPSE
LPQRGGEVNLTLGGIDLNNSGSVVVREDKKLLTVLFPDGRDGRGFTLKAESSEDLYEWKT
ALEHALAQAPSAALVMGHGIFRNDASDTVEGSFQQWRDKHPVKSLVVGRPILLALEDIDG
SPSFLEKALCFLEKFGTKVEGILRQSADVEEVDRRVQEYEQGKSEFESDEDAHVVGDCVK
HVLRELPSSPVPASCCTALLEAYRVEGKADRVVALRSAIYDTFPEPNRRLLQRVLKMMHK
ISAHSADNRMTPSAVAACMAPLLLRPLLAGECELEDDFDMNGDDSAQLLAAANAANNAQA
IVTTLLEEYDNVFPGVNLHGCSLSVDPQMENSESEDSTDDGNSNTKDISYHDAANEVNPE
FEDDSERVLSGKLSETSGYSGSDLYDNKVCVDDLDVESPERKHSSPRKLLSEKSVRDTNG
IFKTHNTLKNESEVSIKVMDSPSALVANGSHRSTGDRLTSVDTRIPSHAPSPELCLEKST
VKPNGSKNNVKRSNFWGRSNTRRNTSVDSVDLSGDEETFQSGFSYKLMQSRLFRLAIQRL
EIAKNDLLNRIAKEAKGNAILQASLERRKQALHERRLALEQDVSRLQEQLQAERDLRAAL
EVGLSMSSGQFSDSRGMDSKTRAELEEIALAEADVAKLKQKVTELHHQLNQQRQQHYGSL
SDASNRHQHAQNLHSQLKFMQQDFDMNLAFCNHERKQRTEESSLGADWKSLKAQLLSAAS
NSKQHSRKQLANLTSPSDSRSTEASTSFSADNFSAIDSATMPTTSREMEGLGNQRQTAPS
SSTLVELTTRLDFFKERRSQLMEQLHNLDLASSPQGMVHSPPSPSWR
Download sequence
Identical sequences A0A2G5EWQ2
Aquca_004_00805.1|PACid:22030341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]