SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00001.1|PACid:22023986 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00001.1|PACid:22023986
Domain Number 1 Region: 10-85,113-131
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.09e-27
Family alpha-D-mannose-specific plant lectins 0.0026
Further Details:      
 
Weak hits

Sequence:  Aquca_005_00001.1|PACid:22023986
Domain Number - Region: 313-341
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0228
Family Pan module (APPLE domain) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00001.1|PACid:22023986
Sequence length 378
Sequence
MTLALRLDTRVVWEANRGKPVHKNSTVSFGQDGNLVLADAHGNVVWQTNTANKGVVDLQM
LPNGNMVLVNTKGEYVWQSFDHPTDTILVSQSLLPGDKNKLVSRISAIDNRDGPYSLVID
GERIIFYYKSKRSAMPEIYSLMKPMFIEGGVLEKMTVQSYHASTDPYLHDILLNFTLLDK
SSFALGTAELTYNATYSFLQLGQDGNLRIYTYYDKLYGWTGRNAWHATFTLFSADLPYLE
SQCQLPEKCGNFGLCEDNQCVACPTPKGLMGWSKKCSPPKLPRNCNGAENVEYYKIAGVD
HFSSSYSGEGPMRLVECKEKCNEDCKCLGFFYNEDTSMCLATHQLKTLTKVSNSTHLAFI
KMAKQDHPISQYLDFLAM
Download sequence
Identical sequences A0A2G5EQ76
Aquca_005_00001.1|PACid:22023986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]