SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00022.3|PACid:22023847 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00022.3|PACid:22023847
Domain Number 1 Region: 509-544
Classification Level Classification E-value
Superfamily WW domain 0.0000000000408
Family WW domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00022.3|PACid:22023847
Sequence length 1254
Sequence
MASSPSQRDGCLRDTSVVVVTLDTSEVYIIVSLSTTNDTQVIYVDPTTGGLCYSGKLGHD
IFTSEDEALSNVTNGSKWLCKSITYGRAILGYSALGSFGVLLVATKLASAIPNLPGGGRV
YTVTESQWIKISLQNPQPQGKGEVKNIQEMSDLDIDGKHYFCETRDITRPFPSRMPLQKP
DKEFVWNEWFSLPFKDIGLPQHCVILLQGFVECRAFGSSGQQEGVVALTARRSRLHPGTR
YLARGLNACFSTGNEVECEQLVWIPKRTGQSIPFNTYIWRRGTIPIWWGAELKMTAAEAE
IYVSARDPYKGSSEYYERLSKRYGAPNIDVNSKGHTAKSPLVPITCINLLRYGEGKSESI
LVQHFVESVNFIKSSGKLPHTRIHLINYDWHASTKMKGEQQTIEGLWKFLKAPTTTVGIC
EGDYLPSRLRLNDCKGEIICTDGLEGAFCLRSHQNGVVRFNCADSLDRTNAASYFGALQV
FVEQCRRLGVSLDSDLAYGHASSNNYGGYIAPLPPGWEKRSDAVTGKAYYIDHNTRTTTW
AHPCPDKPWKRFDMTFEEFKRSTILSPISQLAEIFLLAGDIHATLYTGSKAMHSQILNIF
TEEPGKFKQFSVAQNMKITLQRRYKNTVVDSSRQKQLEMFLGVRLFRHLPSISIHPLQVL
SRSSAFFLKPVANMIPSSNGSANLLSFKRKNVIWVCPQAADVLELFIYLSEPCHVCQLLI
TVSHGADDSTFPATVDVRTGRNLDGLKLILEGASIPQCTNGTNLLIPLAGAVNPEDMAVT
GAGTRLHAQETPNLSLLYDFEELEGELDFLTRVVALTFYPAVTGKTPLTLGEIEVLGTSL
PWRPIFTKEEPYGKFSEIYSKCKKETNPSQFGSDTNPFGNASVSNESIHSLAPQSAPGSL
AVDLLTGDFGSSESLFQPEVPCSIGNVGSGGGDLLDFLDDAVTYHKGLEVNPEGSFRPQD
GKPTDSRVHHYLNCFKALFGSQMPRNIDFEEAMKLEIERLRLNLSAAERDRALLSIGTDP
ASIDPNGLLDAIYMGRLCKISSHLALLGQAALEDKVNASIGLGNFNDSAIDFWNISGIGE
TCSGDKCEVRAVTRPYAQVTSITSSGGVSSSVFICSRCGRKVCKVCCAGKGALLLSSSNS
KEVSSYSDGISTNNSTILDGVICKSCCNEIVLDALILDYVRVLISMRRVSRADTAAYNAL
DQVIALPPGLHDKNGSSDFHMPVVKKVLKNLLNGEESLAEFPYASLLYSVLFGF
Download sequence
Identical sequences A0A2G5EQ24
Aquca_005_00022.3|PACid:22023847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]