SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00023.1|PACid:22023768 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00023.1|PACid:22023768
Domain Number 1 Region: 198-282
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000046
Family PDZ domain 0.041
Further Details:      
 
Weak hits

Sequence:  Aquca_005_00023.1|PACid:22023768
Domain Number - Region: 96-187
Classification Level Classification E-value
Superfamily FtsH protease domain-like 0.0785
Family FtsH protease domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00023.1|PACid:22023768
Sequence length 444
Sequence
MILNLSTSPLPSTSSLIKLLSISKSPTTHFSKSFFSSSSTSYQKTQYSNQFLFDKRRYPH
GKRDSFRSWAFPGFELGNFESAQSVIEASAVVAAIIFVHESGHFLAAILQGIHVSKFAIG
FGPILAKFNANNVEYSLRAFPLGGFVGFPDNDPDSQIPVDDKNLLKNRPVFDRIVVVSAG
VIANVIFAYAIIFVQVISVGLPVQEVFPGVIVPEVRASSAAARDGLLPGDVILSVNGLEL
PKNATNSVSQLVDIIKQSPNKNVSLKIARGQKDLDIGVTPDESVDGTGRIGVQLSPNFKI
SKIKAKNIMEAMSFAGKEFGGLSSNVLDGLKQTFFNFSQTASKVSGPVAIIAVGAEVARS
SIDGLYQFAAVLNINLAVINLLPLPALDGGTLALILVEAARGGKKLPQEIEQRIMSSGIM
LVFLLGIYLIIRDTLNLDFIKELL
Download sequence
Identical sequences A0A2G5EPX8
Aquca_005_00023.1|PACid:22023768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]