SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00141.1|PACid:22023763 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00141.1|PACid:22023763
Domain Number 1 Region: 496-800
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.78e-82
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 75-187
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.28e-29
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 
Domain Number 3 Region: 358-426
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000785
Family Hairpin loop containing domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00141.1|PACid:22023763
Sequence length 829
Sequence
MKTSFSVFLFRVFFLFHNLDLCFTIETISQNELIRDSNSITSVNQTFKLGFFSPGNSSNR
YVGIWYNSLPGGRLYIWIANRDNPLTDSSGVLRITDDGNLVVLDGKEEVVWTTNVSVIAN
NSRAELLDSGNLVLREVSSSESSNSGQIIWQSFEHPTDTLLQNMKFGANIKTGEKQVVTS
WKTTSDPSKGRFHAELEPLNIPQIVIWEGSQRHWRSGPWDGRIFIGVEGMYSESLNGFGV
VRDEEEGNVYAILSYRRKPLYVMYVLNSLGQLSENRFDEEENRWVQDSLMPETECDFYGK
CGSFGFCDLSNKPVCSCLKGYEPNSIEEWGNGNWSSGCVKRKLFQCEQNHSSSEEGKRDG
FLKHERMKVPDLVNWGRSRDLEDCKQICLLNCSCKAYSYGTGNGCMWWDKDLIDTQRFST
DGVDLYIRVAHSELDEKKNIIHVYIIIVLSGLSVVAICVYIYWRWAMKKKRKTYTGVLVL
GKSGATKKLSDTDKLDPELPIFKYEKLEVSTNNFDPANKLGEGGFGSVYMGKLPSGQEIA
VKRLSKSSGQGTEEFMNEVVVISKLQHRNLVRLLGCCIEGEEKMLIYEYMPNTSLDAFLF
DPKKKALLGWKKCFQIIEGIGRGILYLHRDSRLRVIHRDLKPSNILLDKDLNPKISDFGM
ARIFGGDEIQANTKRVVGTYGYMSPEYAMEGLFSEKSDVYSFGVLLLEIVSGMRNTGFYH
HEESLSLIRHAWKLWNEDKIQMLIDPAISDISWQEEILRCIHVGLLCVQEFAKDRPTMSS
TISMLMSEVLSLPTPKQPAFSGREATSYSDYSNKDCSRNNVSITTVEGR
Download sequence
Identical sequences A0A2G5EQJ1
Aquca_005_00141.1|PACid:22023763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]