SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00142.1|PACid:22024046 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00142.1|PACid:22024046
Domain Number 1 Region: 536-849
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-83
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 115-192,224-255
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.19e-30
Family alpha-D-mannose-specific plant lectins 0.0031
Further Details:      
 
Weak hits

Sequence:  Aquca_005_00142.1|PACid:22024046
Domain Number - Region: 418-468
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000145
Family Pan module (APPLE domain) 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00142.1|PACid:22024046
Sequence length 873
Sequence
MNQIPNSMLAAQYTRSMYFMISKSFGSFFFSFIEEELLHLSKLMNITRFLAFCVFIFCYL
DFCFAIQTISLNNPISDSDSITSLNQEFRLGFFSPGNSSNRYVGIWYNSLPGDKTVDWVA
NRDNPLTDSLGVLRINHDGNLVILDGKQRIIWTTNVSVSVNNSRAELLHTGNLVLRSNLG
KLLWQSFDHLTDTFRPNMKLAANTKTGEKLGLTSWKTDIDPSKGRFRLVLEPLNIPQVYI
WEGSQRHWRSGPWDGRVFIGVEGMYADPLNGFSLLRDEDEGNVYLTVHFRRKPVNVTNVR
YFLNSLGQLTENVFVQGENVWVQDWAIPAKECDYYGYCGTFGFCSVLSKPICSCLEGYEP
TSIEEWSKGNWSSGCVKRKPFRCERNNSRSEEGKEDGFIKHDRMKVPDNMVNWVHGSDFF
GRELDDCKQTCLRNCSCRAYSLGNGGCMWWHGNLIDMQRFSMDGVDLYIRVAHSELDEKN
MMLVSIVVVLAGLLVATVCMYIFWKWAMKKKRKTYMRVLVLDEKDTTIELTDTDNLDPEL
PIFKYDKLAVSTNNFDPENKLGEGGFGPVYMGKLPSGQEIAVKRLSKSSGQGREEFMNEV
VVISKLQHRNLVRLLGCCIEGEEKMLIYEYMPNKSLDAFLFDPNKKALLGWKKCFQIIEG
IGRGILYLHRDSRLRVIHRDLKPSNILLDEDLNPKISDFGMARIFGGDEFQANTRRVVGT
YGYMSPEYAMEGRFSEKSDVYSFGVVLLEIVSGMKNTSFYRNEESVSLIKHAWKLWNEEK
IQMLIDPAIFDLSCKEEILRCIHVGLLCVQDFPRDRPTMSSTISMLNSEISSLPTPKQPA
FSGLEVTSFSDSSHSSDKVCSRNNVTITILEGR
Download sequence
Identical sequences A0A2G5EQJ0
Aquca_005_00142.1|PACid:22024046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]