SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00157.2|PACid:22023820 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00157.2|PACid:22023820
Domain Number 1 Region: 14-94
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.12e-17
Family B3 DNA binding domain 0.0042
Further Details:      
 
Domain Number 2 Region: 206-309
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000216
Family B3 DNA binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00157.2|PACid:22023820
Sequence length 310
Sequence
MKRSKFFRLIGSEDCQLEVPSEFVEEHGNQLSDVGVLKVRTGDTWNIGLRRFAGRIVFNG
GWKEFADHYSLDAGYCLFFTYSGNSRFDVVICDPGDAEIIYPTKPVKFKEPMLDVETVLP
VTKSNGTEKKFVKKLSITCNKENLRESVLSAGKHHQEKQIIELGEPSLCQMVEDVATNKV
LAAKPSFLQTKEKDGGVSTAMPFMSNHPFFKLNVSSAYYKHRHMFFPRQFLESHMPEFNS
SVTVTLQVANMEKKWLVGCYSTCYKNSRSWRMSKGLGKFLRENSIKIGDSCVFELIDKEN
VVFNVIVFSQ
Download sequence
Identical sequences A0A2G5EQK5
Aquca_005_00157.1|PACid:22023821 Aquca_005_00157.2|PACid:22023820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]