SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00175.1|PACid:22023621 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00175.1|PACid:22023621
Domain Number 1 Region: 71-254
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.11e-32
Family Pseudouridine synthase I TruA 0.0016
Further Details:      
 
Weak hits

Sequence:  Aquca_005_00175.1|PACid:22023621
Domain Number - Region: 346-424
Classification Level Classification E-value
Superfamily Pseudouridine synthase 0.00173
Family Pseudouridine synthase I TruA 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00175.1|PACid:22023621
Sequence length 515
Sequence
MTVSSLRFSLSPWIKNPSFKSPFITTTKKSLIITCINLRRSSSSSSTSSPSLEKLKEQVE
EGNGERWEPYRKKKVVMRVGYVGSNYRGLQIQRDEPSFTTVEAELENALFRAGGIRDSNY
GDLHKIGWARSSRTDKGVHSLGTTISLKMEIPETAWKEDPYGIALANYVNSNLPNDVKVF
SILPSQRKFDARRECNVRKYSYLLPAEIIGIRSDISSDEIDYHLSEFNNILRSFEGEHPF
HNYTIRSKYRRQSPRKSQMQSVIESPKEASASESESGDELEECGVDYKAALDISGDSLGP
SHSSDVKEHSVSIHEKHGDGLQDQGSTVPLRARWLYEPDGRDRIGASHFRKIYICSCGKL
EKSSGIDYVEISICGGIRKMIGTAVAVKRKLLPQDFIELSLIKFSRIVVPLAPSEVLVLR
GNQFSLRKSQVNIIRSEVMKQVESEEILKAVNEFYESVMLPQVSKFLDPSNTPWKEWVET
LDANTSIPDEEWEEVRRAWKSWKESYRTRTEASAL
Download sequence
Identical sequences A0A2G5EQP4
Aquca_005_00175.1|PACid:22023621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]