SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00182.1|PACid:22023800 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00182.1|PACid:22023800
Domain Number 1 Region: 75-166
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000000157
Family alpha-D-mannose-specific plant lectins 0.0066
Further Details:      
 
Weak hits

Sequence:  Aquca_005_00182.1|PACid:22023800
Domain Number - Region: 339-378
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0149
Family Pan module (APPLE domain) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00182.1|PACid:22023800
Sequence length 449
Sequence
MVFFFTPGLCKSYIPIGFQVRIPVPSMYNNSFLGRAFFIETSYEVPNFKVGLSVEAVNGD
HSCSLGVFLGDYRVWNSAHFMQFYARGICMLELTKYGNLQLRDSKGGIGWRSGTSLQGVE
RLQLLRSGNLVLTDAMDLIKWQSYNFPTDGMLWGQRLSVSTFLTSFSNSSSIFYSFEIQN
NKLALYLNSDKQKYSYWEFRLTKNRSIAFAEFGSTGLKLFDGKVRKLAQILPKRLEPLRF
LALEKNTGNLKFYHYSALKGKFEASFEAINSTCDLPMACGPYGICTFSNNCTCIQFSRKM
YRHDPNCSEDFSSKFCQSTSPVEMVEIMGVKSILRVPPQRVNVSKEECLNLCVHDCKCAA
VLYSVTGTAIFLQECYHYGVVRGLKQVEQGIGLSYLVKVPKGVGGDSGKSWNAKTWLLIT
GGVIDGLVILLVMGGFAYYMFVIRRRNSL
Download sequence
Identical sequences A0A2G5EQR5
Aquca_005_00182.1|PACid:22023800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]