SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00187.2|PACid:22023965 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00187.2|PACid:22023965
Domain Number 1 Region: 449-755
Classification Level Classification E-value
Superfamily ARM repeat 4.94e-33
Family PBS lyase HEAT-like repeat 0.083
Further Details:      
 
Domain Number 2 Region: 1041-1332
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.83e-30
Family WD40-repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00187.2|PACid:22023965
Sequence length 1340
Sequence
MALGDLMASRLSQSTTSVSNHLDDFSSRDDGDFLGQRRVGGSGGGGDSETASSNGGGSGS
VSGGVNVAQTTTTMTTTSMAYLPQTIVLCELRHEAFEAYTPTGPPDTGIYSRWRPKDRMK
TGCVALVLCLNISVDPPDVIKISPCARMECWIDPFSMAAPKALDSIGKALVNQYERWQPK
ARYRLQPDPTVDEVRKLCLACRKHAKGERVLFHYNGHGVPKPTANGEIWVFNKSYTQYIP
LPISDLDSWLKTPSIYVIDCSAAGMIVNAFIERQDWGSSGSSLKDCILLGACEAHESLPQ
SAEFPADVFTSCLTTPIKMALRWFCSRSLLRDTINHSLIDRIPGRQNDRKTLLGELNWIF
TAVTDTIAWNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMRSANCSPVSYPVLPSTHQH
HMDAWDMAAEICLTQLPSLLDDPNAEFQPSPFFTEQLTAFEVWLDHGSEHKKPPEQLPIV
LQVLLSQCHRFRALVLLGRFLDMGPWAVDLALSVGIFPYVLKLLQTSAMELRQILVFIWT
KILALDKSCQVDLVKDGGHTYFIRFLDSMDAYPEQRAMAAFVLAVVVDGHRRGQEACISA
DLIHVCLKHLQLANPHDAQTEPLLLQWLCLCLGKLWEDFPEAQMIGLQADAPAVYAPLLS
EPQPEVRASAVFGLSTLLDIGSDSFRDGGGDEDCDDDERVRAELNIVKSLLTVVSDGSPL
VRAEVACAFARFAFGHNKHLKSIASAYWKPHSNSLLSSLPSLANINSSGGQPGSNIPSQI
GPVLRVGSDSATAGRDGRVPTSSPLATPGIMHGSPLSDDSSQHSDSGILLNDSASNGVMN
YSRPRPLDNGMYSQCVLAMCTLAKDPSPRIAGLGRRILSMIGIEQVITKTHRFGGSSVRQ
GDPSTSSPSPHLGALARSSSWFDMNAGHLPLTFRTPPVSPPRQNFLTTGMRRVCSLEFRP
HLLNSPDSGLADPLLGSTIGVSERSLLPQSTIYNGSCGHFSRPLLTAADDNDEILIRREQ
KEKLALDRIAKCQHSSVSKLNNQIASWDTKFETGTKTALMQPFSPVIIAADESERIRYLL
SDGNIRVWKDYSLKGKQKLVTAFSSIQGHRPGVRCLNAVVDWQQQSGYLYASGEISSIML
WDLDKEQLVNSIPSSSETSISAMSASQVHGGQLVAGYVDGTVRLFDIRTPEMLVCTTDPH
RPKVERAVAQKVERVVGIGFQPGLDPGKIVSASLAGDIRFLDIRSSTDPYLTIDAHRGSL
TALAIHRHAPVIASGSAKQLIKVFSLGGAQLGSIRYYPTFMGQKIGSVSCLTFHPYRFFL
AAGAADACVSIYADDSSQAK
Download sequence
Identical sequences A0A2G5EQT1
Aquca_005_00187.2|PACid:22023965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]