SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00206.1|PACid:22023794 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00206.1|PACid:22023794
Domain Number 1 Region: 144-160,218-326
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.31e-30
Family Staphylococcal nuclease 0.0018
Further Details:      
 
Weak hits

Sequence:  Aquca_005_00206.1|PACid:22023794
Domain Number - Region: 165-215
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.000471
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00206.1|PACid:22023794
Sequence length 337
Sequence
MGNALRFLYGNCCKPTTQEYGYGYGVPTYTDGLSALVHDIYHFETTSQVPEGLGRHVVSS
KKAQANWYKKLAEAWKAAKPPPRTPDEAARLVILTLKNHLKADVEGLLAYYGLPSPQALV
QTSELLPPSNSHPPQGVKFELQTLPVDAKAVADGDTVTVYVNTVDPREAANLPRDVKLAA
TQRAKARAVRDYVKADALQKKIVDAGYRVLTGPNNEDILARKYRIRLRGIDAPESSMPFG
KEAKDEMTKLVQGKCLRVLVYGEDRYNRYVGDIYCNNKFVQESMLKKGLVWHYTAYDKRP
ELASWEKAARTARVGLWSSSNPEEPWEWRKKRRNKDA
Download sequence
Identical sequences A0A2G5ER17
Aquca_005_00206.1|PACid:22023794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]