SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00206.2|PACid:22023795 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00206.2|PACid:22023795
Domain Number 1 Region: 144-160,218-283
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.05e-16
Family Staphylococcal nuclease 0.0056
Further Details:      
 
Weak hits

Sequence:  Aquca_005_00206.2|PACid:22023795
Domain Number - Region: 165-215
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.000379
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00206.2|PACid:22023795
Sequence length 294
Sequence
MGNALRFLYGNCCKPTTQEYGYGYGVPTYTDGLSALVHDIYHFETTSQVPEGLGRHVVSS
KKAQANWYKKLAEAWKAAKPPPRTPDEAARLVILTLKNHLKADVEGLLAYYGLPSPQALV
QTSELLPPSNSHPPQGVKFELQTLPVDAKAVADGDTVTVYVNTVDPREAANLPRDVKLAA
TQRAKARAVRDYVKADALQKKIVDAGYRVLTGPNNEDILARKYRIRLRGIDAPESSMPFG
KEAKDEMTKLVQGKCLRVLVYGEDRYNRYVGDIYCNNKFVQVKYLNSKPLFHIV
Download sequence
Identical sequences A0A2G5EQT9
Aquca_005_00206.2|PACid:22023795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]