SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00248.1|PACid:22024358 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00248.1|PACid:22024358
Domain Number 1 Region: 68-143
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000126
Family B3 DNA binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00248.1|PACid:22024358
Sequence length 383
Sequence
MEEGKFGMLIKSEEKKDNENENEGIDEDQMTLAQCFQSLQRSPDPDTPNPLCMLCAIERA
EEVRANLDPRFPSFVKSMFPSHVSKGFWMRLPVEFCNAHLPKHDVKMTLIDENQEEFVIN
YLWDKIALSGGWKCFALAHKLVVHIIRACSLGAIDGVIGLLTLDSDAKHSSTSPRKQKFG
SDSDDMGSEVLKSIEFLETSVEFKDVKDLESFTIAVNGLVIDSELSKNEQTKYYELCCSQ
DAFLHDNLLAGINMKLAVGAISETVNIADAIKSSKLGTCRDDYATWDNSLRALGQLGMNV
GFLRARIQKLLNIAYESEGVVDLKRYSEAIVGQARVKEEIRSMKAKLVELEKASKSMGTK
IKNLKAKVRSHELKFHTQVSSPW
Download sequence
Identical sequences A0A2G5ER16
Aquca_005_00248.1|PACid:22024358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]