SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00285.1|PACid:22023761 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00285.1|PACid:22023761
Domain Number 1 Region: 148-283,317-428
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.84e-17
Family WD40-repeat 0.018
Further Details:      
 
Domain Number 2 Region: 74-122
Classification Level Classification E-value
Superfamily F-box domain 0.000000283
Family F-box domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00285.1|PACid:22023761
Sequence length 431
Sequence
MSSSSSSDDEESGNRRRDYYHHQFEGPSSSRQRSSSSSSYNNEVWPEPFLEALVYQVAVD
AVQTLGPLSVAPALSNVFQVCTTWQAISRSDHLWRNLTRQIWHRDVLLHNTWQSEYHYLH
RTCSNFRTRRAVYTSLVIPQEYVDVDDNHNFLTCRRLALSDYHLACGLVDGSIRLFDLTT
RLHVSTFRPQQRDHLGLFSRAVSGIVLTESQLVFASLDGDLHVAVIGNGENPNNPRRVQL
GNVVNDGNFGLYAGVPGRSFHVWNAETEQLVFIGGSLTDPEIASTAIRLMSLEIRNHDGM
MVVLNEEEQVVERSLIVDSVDVSSNTERFILVDNRQRFARIRQVGDFEEVCRFRIRGGGG
GGGGGLMGCINGGCVFIWSGGVIRAWDARNGEVLYNLTDRIGEVTALIADDRHVACTCAD
GTIHLWDFGAI
Download sequence
Identical sequences A0A2G5ER64
Aquca_005_00285.1|PACid:22023761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]