SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00354.2|PACid:22023693 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00354.2|PACid:22023693
Domain Number 1 Region: 222-287,364-522
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.69e-21
Family WD40-repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00354.2|PACid:22023693
Sequence length 1318
Sequence
MASAGNPNQQPGPFDVQKLFRQSPNPNSNLNVLPSPPPPLPLPSSSYPPPSSPFSYPTQT
LHPHHYMPYPPPPPQDPSPPPPPNMHLQQRTLSYPTPPLQPPPQQQQQQHRSPNHNDGAR
LMALLGTTPSSDSSSPIPPPSSIQPSLPVFPSAPPANLATTQHSAPMRLLSTKQPKGRRL
VGDHRVVYDVDVRNQGEVQPQLEVTPITKYVSDPSLVLGRQIAVNKSYICYGLKMGSIRV
LNINTALRHLLKGHTQRVTDMAFFAEDVHFLASASVDGLVFVWKIDEGPDAEDKPQITGK
VVIAIQMVGEGEPVHPRVCWHSHKQEFLVVGIGKRVLKIDTTKVGKGEVFSAEEPLKCSL
DKLVDGIQLVGKHDGEVTDLSMCQWMTTRLVSASSDGMVKIWEDRKALPLAVLRPHDGQP
VNSATFLTAPHSPEHIVLVTAGPLNREVKIWVSASEEGWLLPSDADSWKCTQTLDLKSSA
ETRAEEAFFNQVVALPCAGLILLANAKKNAIYAVHIEYGQCPAATRMDYIAEFTVTMPIL
SLTGTSESLPDGNHIVQVYCVQTQAIQQYALDLSQCLPPPLESMGLEKADSNANQTFGKS
SSDRLPSLEASQGSVPTEIPVVSAAYKQHIVTNNESAPSARYPISSGVPDVSSLHDLSTL
ETKQNVVPSTVSDADSILVASPSVPLSPRLSGNLSGFRSPSNNFDPSSPLGIRPIEQQVL
DYSADGRAETVPANISDSSLLDDNSRKAGTKKQNDISTVPIHLVTPSELNSGVSSSDNAQ
GLSGGEVSFQDLVNNNDLDSAEVEVKVGDSEKCQNDEFESQREAAIHVAEKKEKAFYSQA
SDLNIRMARECCSLSTEVHNADNSVVKEAFDISSNAGEEEFQDSSKDGLVSISESVSVNA
THTPLSGTKVKKQKGKNVQVSGSSSTSPSPFNSTDSFIEPGNSTNLPPGSESSSSNIQAL
LETLVNQQIAMQKEIAEMQKQILAMQVKEGKRLETALGRCIEKTNKTNIDALWARFQEEN
MKHEKLERERTQQITSSIANSNKESAAILDRTLKKELAAVGQAVARQVTPAVEKSTSSAI
TESFQRGVGDKAVNQLEKSINTKLEATVARQIQVQFQTSGKQALQDGLKSCLEASVIPGF
EMSCKSMFEQVDTAFQKGMIEHTTAAQQQLDSTQSTLALALREALNSATSITRTLSGEIA
DGQRKLLALATAGANSKAINPLATQLSNGPLGSLHEMVEAPMDPTKELSRLISERKFEEA
FTGALQRSDVSIVSWLCSQVCFNFTCVYIAIDLRCRFFLHFSIFVFQKLVGVLNLVVG
Download sequence
Identical sequences A0A2G5ERJ7
Aquca_005_00354.2|PACid:22023693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]