SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00391.1|PACid:22024447 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00391.1|PACid:22024447
Domain Number 1 Region: 99-246
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.2e-53
Family C-terminal domain of ribosomal protein L2 0.00000688
Further Details:      
 
Domain Number 2 Region: 1-97
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.25e-22
Family Cold shock DNA-binding domain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00391.1|PACid:22024447
Sequence length 259
Sequence
MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAK
VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGKKANLMVGNVLPLRSIPEGAVVCNVEHHV
GDRGTLARASGDYAIVISHNPDNGTSRIKLPSGAKKIVPSGCRAMIGQVAGGGRTEKPML
KAGNAYHKYRVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLIAA
RRTGRLRGQAAANLAKEKA
Download sequence
Identical sequences A0A2G5ERR1
Aquca_005_00391.1|PACid:22024447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]