SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00391.3|PACid:22024449 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00391.3|PACid:22024449
Domain Number 1 Region: 53-167
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.99e-37
Family C-terminal domain of ribosomal protein L2 0.0000454
Further Details:      
 
Domain Number 2 Region: 1-67
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000446
Family Cold shock DNA-binding domain-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00391.3|PACid:22024449
Sequence length 180
Sequence
MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAK
VTFRHPFRIKLPSGAKKIVPSGCRAMIGQVAGGGRTEKPMLKAGNAYHKYRVKRNCWPKV
RGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLIAARRTGRLRGQAAANLAKEKA
Download sequence
Identical sequences A0A2G5ERQ6
Aquca_005_00391.3|PACid:22024449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]