SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00462.1|PACid:22024062 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00462.1|PACid:22024062
Domain Number 1 Region: 483-775
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.02e-75
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 61-208
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.02e-23
Family alpha-D-mannose-specific plant lectins 0.0037
Further Details:      
 
Weak hits

Sequence:  Aquca_005_00462.1|PACid:22024062
Domain Number - Region: 173-262
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0198
Family alpha-D-mannose-specific plant lectins 0.0076
Further Details:      
 
Domain Number - Region: 296-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0949
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00462.1|PACid:22024062
Sequence length 798
Sequence
MASFFHHLFCFLLLQLPLFISAQTYNNITLGTSISNLQENPYWTSPSGDFAFGFYPHQNL
FLLATWYSKIPVRTIVWTANDGKPVERGAKIQLISNGVLSLTTSNGTEIWKAEAIDNSQV
AYAAMLNTGNFVLFTAESRFVWATFDNPTDTIMPNQVLDLGKKLSSRLTKEDYTIGRFEL
VLQGDGNLEFYTIARPTDSRNDPYYGSNINDNGTQLVFNQSGYIYITLKSGGVHSLSSAR
PLSTEDYYQRATLDYDGVFRQYTYTKVSANGTWPESWSTSWSLPQDICTSNFGEFGSGVC
GFNSYCRLAEDQRPVCLCLPGYSYLDPTNTFKGCIPNFTQQACGTVEPRIVDGFEMQRLP
STNWPMGDYERFLSMNEEWCSETCLKDCLCAAAHIGVRGCWLKKFPLSRGYMTSGTGVSL
IKVANSSAERIPRTAYNGNIEEDKKWIIPGSILLAISVVVNLLFLFLVIYIGCYKKKTKR
QTYTRPFGGNLRSFTYKELNEATDGFKEQLGKGAFSTVYKGELKSDSGCLVAVKRLDKVV
EGNDKEFQAEVSAIGKTNQKYLVQLLGFCNEEAHRLLVYEFMKNGSLENFLFGSLRLKWN
QRIQIALGIARGLAYLHEDCSSQIIHCDIKPQNILLDESYVARISDFGLAKLLKSDQTRT
TTGIRGTRGYVAPEWFRNMPITAKVDVYSFGIMLLEILFCRKNVELKVGDEEIEILSDLA
YEYYQQKELHLLLVNDEEAKNDGKSLESMVMVALWCIQEDPSLRPSMKKVTQMLEGAVEI
SMPPSPNPSSFSNISPIV
Download sequence
Identical sequences A0A2G5ES37
Aquca_005_00462.1|PACid:22024062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]