SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00464.1|PACid:22024291 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00464.1|PACid:22024291
Domain Number 1 Region: 62-210
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.06e-25
Family alpha-D-mannose-specific plant lectins 0.0039
Further Details:      
 
Weak hits

Sequence:  Aquca_005_00464.1|PACid:22024291
Domain Number - Region: 173-263
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000256
Family alpha-D-mannose-specific plant lectins 0.0056
Further Details:      
 
Domain Number - Region: 369-408
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.051
Family Pan module (APPLE domain) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00464.1|PACid:22024291
Sequence length 443
Sequence
MASLFQYLLCMVLLQLPLFISAQTYNNITLGSSISNLDEKPYWTSRSGDFAFGFHPHHKD
FFLLAIWYAKIPVKTIVWTANDGKPVERGAKIQLTSNGVLSLTTSNGTEIWKAEAIDNSQ
VAYAAILDTGNFVLSTAESKFVWATFDNPTDTILPNQVLDLGNKLSSRLTKDDYTVGRFE
FVLLGDGNLVFYTIARPTEKRNEPYWASGTVDSGTQLEFNQSGYIYLTLKSGGIRSLSSE
RPVSTEEYYQRATLDYDGVFRQYTYPKSSPTNGWPESWSTFWSLPQDICTSSFGEFGSGV
CGFNSYCKLDKDQRPECLCPPGYSFIDPDNSFKGCKPNFVQQVCKADESRIVDGFEMQVL
SNTDWPFADYEWFKSVNQDWCEKTCLKDCFCAAAISRRGGDDCWLKKFPLSRGFMNPSSD
RIALIKIQTLEHLNNNGMNLSAE
Download sequence
Identical sequences A0A2G5ESB6
Aquca_005_00464.1|PACid:22024291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]