SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00495.3|PACid:22024080 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00495.3|PACid:22024080
Domain Number 1 Region: 126-218,258-318
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 0.0000000000353
Family Lysine biosynthesis enzyme LysX ATP-binding domain 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00495.3|PACid:22024080
Sequence length 378
Sequence
MSESMRRFGIGYALAPKKQQSFIQVSLVNLAKERGVDLIKIDTEKPLVDQGPFDCILHKL
PGEEWRKQLEDFSLKNPNVLVIDHPDSIERLHNRISMLQVVSELTSPPAAAAVGGVENQN
EETFGVPKQIVIYTNEALLDPVVLLDLKFPVIAKPLVADGSAKSHKMSLVFNRDGLNKLK
PPIVLQEFVNHGGVIFKVYVVGDHVTCVKRKSLPDVSEEKLASLEGSLPFSQISNLTGQD
RLDENYYEAMHLDQAEMPPLSFITDIARGLRRAMRLHLFNFDVIRDVRVGNRYLVIDINY
FPGYAKMPLYETVLTDFFVEIFQKTKEENLKVDANCSKLVGSEKEERKLVSNTCGDENDG
DVPVSGLSREEKENTLQV
Download sequence
Identical sequences A0A2G5ES72
Aquca_005_00495.1|PACid:22024083 Aquca_005_00495.2|PACid:22024082 Aquca_005_00495.3|PACid:22024080 Aquca_005_00495.4|PACid:22024081 Aquca_005_00495.5|PACid:22024079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]