SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00538.1|PACid:22024133 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00538.1|PACid:22024133
Domain Number 1 Region: 96-222
Classification Level Classification E-value
Superfamily Smc hinge domain 0.0000000000196
Family Smc hinge domain 0.0054
Further Details:      
 
Weak hits

Sequence:  Aquca_005_00538.1|PACid:22024133
Domain Number - Region: 5-102
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0837
Family Myosin rod fragments 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00538.1|PACid:22024133
Sequence length 222
Sequence
MLVQVAKSIKDIEKSIIERNSVVQRAGDGAADLKKRVEDLTKNLEEYEKVYQGVLAGKNS
GDEEKCLKDQLCDAKAVVGSSETELKDRQVEFDVVQKLRDEVRILKGQLSNVHFQYRDPI
NNFDRSKVKGVVAELIKVRDSSTMTALEVYFEVAAGGKLYNVVMNIKLTGKQLLKSGDLR
RRVTIIPLNKIQSHTVPPRAQQAAIRLVGEGNAELALSLVGY
Download sequence
Identical sequences A0A2G5ESD6
Aquca_005_00538.1|PACid:22024133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]