SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00549.1|PACid:22024124 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00549.1|PACid:22024124
Domain Number 1 Region: 53-296
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.02e-64
Family Extended AAA-ATPase domain 0.00000041
Further Details:      
 
Domain Number 2 Region: 306-495
Classification Level Classification E-value
Superfamily FtsH protease domain-like 1.31e-55
Family FtsH protease domain-like 0.0000239
Further Details:      
 
Domain Number 3 Region: 543-592
Classification Level Classification E-value
Superfamily F-box domain 0.000000497
Family F-box domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00549.1|PACid:22024124
Sequence length 592
Sequence
MNFLEKVILCKEIMFLGHTALCVAFIAYIWRQVTIKNTERKEQFFELEKNTRKKVCFDDV
AGCDEAKQEIIEIVEFLKNPKKYENFGAKIHKGVLLVGPPGTGKTLLAKAIAGESGVSFL
SISGSDFVQYVGAGPSRMRSLFSEAKKCAPSVIFIDEIDAIGRARQEDGNYERGSTLNQL
LVEMDGFGSTNGVVVLAGTNMPDMLDKALLGPGRFDFQISIDTPDIRGRDQIFRIHLKAV
KLDPKATNLAQKLAVLTPGFTGADIAKVCNEAALIAARTDSEWVTMDHFESAMDRIFFGP
EKPNKVISKQDRRTVAYHESGHTVTAWFLEHIEPVRKVTIVPRGSSTLGCTQCAPSENRI
MTEKQFFDIACVTLGGRASEQVMLGEISTGSRDDLEKLTEMTYELVTRDGFSDKVGILSF
PPGNKGSENLQPYSNNTRVAIDAEVKKWVQEAYDHTLQIIKDHEEHVDHIAKQLLEKEVL
YEEDLIKVLGERPWKTRILCGLKKQNKIISKQDRRIVATSPSDFGSFYAKIRSSGHCGSQ
PQEDGESDEETPTDSTVSLPNDVLEEVLSRLPDCSVLSCTSASKTLRELIYS
Download sequence
Identical sequences A0A2G5ESF0
Aquca_005_00549.1|PACid:22024124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]