SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00595.1|PACid:22024380 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00595.1|PACid:22024380
Domain Number 1 Region: 66-608
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.23e-95
Family Acetyl-CoA synthetase-like 0.0000058
Further Details:      
 
Domain Number 2 Region: 806-1168
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.06e-41
Family Quinoprotein alcohol dehydrogenase-like 0.012
Further Details:      
 
Domain Number 3 Region: 625-687
Classification Level Classification E-value
Superfamily ACP-like 0.000000558
Family Peptidyl carrier domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00595.1|PACid:22024380
Sequence length 1173
Sequence
MAKEEERSEEKPDHHHRCCCCICHEFFKSASQNPHKIAVIHASGGARICRQFGYNSNNNK
FFRSKSNPFCFHGDELFTYSEILTSIKSLSYLIRHVLDGANDPDLIKPSDSEHVDNATIT
STDTPQILAIYMVPSVEYIVAVLSVLRTGEAFLPLDPSWPKQRILSIISLAKVAMILKCK
TSFHSSDSHQLEKSEWLADRTGCAVLEMSMKKNHDKDFEFLDLEWPCQSVKVRKFCYLMY
TSGSTGKPKGVCGTETGLLNRYLWMQELFPLHGEEILLFKTSISFIDHLQEFLSAILTCV
PLVIPPFEEFKINPFYMADFLKAYCISRLIMVPTVMRAILPAIQSLYIRDVQNCLKVLVL
SGEVLSVALWDVLHKILPKTSILNLYGSTEVSGDCTYFDCKRLPMILKTELLSSVPIGIP
ISNCEIVLVGEPNEFSQGEIYVGGTCTSLGYFLDPTVSSSNYIELSQVSGHCNGIPFLDK
GCRSYFRTGDYARRLHTGDLVLIGRKDRTLKLNGQRVALEEIENSLREHPNIIDVAVISH
EGQEKFVYLIAYIVLKAHDEIHMLDSHIRNWLAQRLPPAMIPNRYVCIESLPRTSSGKVD
YGYLPDPAFISKKIKSNTHITLGDSDLLEVIEKVFSNALMIGKVKKDDDFFEMGGNSITA
AQVAYKLGIDMRLLYTFPSPCKLLSALRDNELAYKLDFGTSVDWEGKPKVAYKKRLSGSS
LEICAGANNESALSVKRLKVDSNTYELLNSTTPGHDMPWKSSFFLSKTCSFSRCNKVVYG
GKYEANDVRQACWSAKYPINGKACMRELWKVHLKSCVDASPLVVSKDGDVYVFIGSHSQT
FLCVDAVSGNLQWEAKLEGRIECSAAIVDDFSQVVVGCYKGKIYFLDFMTGNVRWAFDTL
GEVKSQPVLDMQRKLIWCGSYDHTLYALDYKNHCCVYHISCGGSIYGSPSINTVHNMLYV
ASTTGRVTAILIEASPFRCMWIHELGVPVFGTLVSSPNGNVICCSVDGHVTVLSISGSVI
WKAITGGPIFGGACLSNALPSQVLVCSRNGSIYSFDLEKGDLLWEFNIADPITSSAYVDE
NMQLISDPSHPSDRLACICSSSGSLHVLRVNSGVQSKTKQAAKDAVSFTVQEFAKMELPG
DIFSSPVMIGGQIYIGCRDDFVYCIKVEVSVPV
Download sequence
Identical sequences A0A2G5ESY1
Aquca_005_00595.1|PACid:22024380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]