SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00616.1|PACid:22023937 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00616.1|PACid:22023937
Domain Number 1 Region: 495-799
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-81
Family Protein kinases, catalytic subunit 0.000083
Further Details:      
 
Domain Number 2 Region: 58-167
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.85e-23
Family alpha-D-mannose-specific plant lectins 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00616.1|PACid:22023937
Sequence length 830
Sequence
MSLYSLVASHTIVQGEQIKDGETIESAEGNFVLGFFSPPNSKNRYVGIWYKRVTNQTVVW
VANRERPLIDSTGTLMINNDGNLVIMDWRGGLIMIAYGSVNGNTTAEFLENGNLVLTEGN
NTANNKRILWQSFDYPTDSFLPGMKLGRNLNSKQNRLLTSWRSADDPAPGVYSFGADPNG
TTQFFIWQEGIIYWTSGLFSGRSFVRVRETGIRSLFNYSFVRNDEEQYFTYSFYNKSIIS
RFVLQYSGQIQQLTWSVEAQTWTIFWTYPEDRCDVYAPCGAYGSCSTNTSSLCRCLQGFA
PASPKDWESDNWSDGCRRQTEIKCGNNDAFLQFNTIKYPNHMQYIEGIGSNTGKCKSMCV
SNCSCTAYSHVNETGCLFWGVNLMGLRENYNKTGQAAGDQEIFIRIAASDLVGGNTPLPI
QEKKKRTWVIVVATVPPASLILGFIVYYIWKITRRPEGNTKRSQDRFALEYGTNISAAGK
GNNAKMFNRDEKGLNLLLFSLSNVVSATDNFSPANKLGEGGFGPVYKGTLPEGQQIAIKR
LSRSSGQGLEEFKNEIKLIAKLQHTNLVRLLGCCIEVEEKMLIYEYMVNGSLDSFIFDSN
KRMKLDGRKRVHIIEGIAQGLLYLHKYSRLKIIHRDLKASNILLDGEMNPKISDFGMARI
FSNNESEEKTRRIVGTYGYMSPEYAMNGKFSVKSDVFSFGVLLLEIISGTKNSSYDHLDS
SSNILGYAYILWKDNKAVELVDPLLDESSPTNELVRYVHIALLCVQESASDRPTMLEVVS
MLGNETTNLPTPKQPAFFIERNVVDGDSPSEGYGVICSANGLTVSLVEAR
Download sequence
Identical sequences A0A2G5ET28
Aquca_005_00616.1|PACid:22023937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]