SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00636.3|PACid:22024040 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00636.3|PACid:22024040
Domain Number 1 Region: 469-672,837-955
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.49e-39
Family Quinoprotein alcohol dehydrogenase-like 0.028
Further Details:      
 
Domain Number 2 Region: 338-525
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.54e-23
Family WD40-repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00636.3|PACid:22024040
Sequence length 1021
Sequence
MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNMKHFEDQVQAGEWDEVERYLGGF
TKVEDNRYSMKIFFEIRKQKYLEALDRQDRAKAVEILVNDLKVFSSFNEDLFKEITQLLT
LDNFRQNEQLSKYGDTKTARNIMLMELKKLVEANPLFREKLTFPPFKNSRLRTLINQSLN
WQHQLCKYQRPNPDIKTLFIDHTCGPNNGAAARGPLTNSPILGPIPKAGTFPPIGAHSSF
QPVGSQSASAMGGWMSNTNPSVPHAAVPAPPVLLQPPNSAPFLKHPRTPPNAPGMDYQSA
DSEHLLKRMCIGPSEEVTFSGVNHPSNVYSQDDLPKIVVRSLNQGSNVMSMDFHPHQQTI
LLVGTNVGDIAIWEVGSRERLAHKTFKVWDVSACSNPLQAALMKDATICVNRCVWGPDGS
VLGVAFSKHIVQTYAYSQMGELRHHLEIDAHIGGVNDIAFCHPNKQLCLVTCGDDQTIKV
WDASSGRRLYIFEGHEAPVYSVCPHYKENIQFIFSTAIDGKIKAWLYDCLGSRVDYDAPG
LWCTTMAYSADGTRLFSCGTSKDGDSHLVEWNESEGAIKRTYSGFRKRSLGVVQFDTVRN
RFLAAGDEFQIKFWDMENTNMTASIDADGGLPASPKLRFNKEGSLLAVTTNDNGIKILGN
SDGQRLIRMLESRTFEGSRGPSELINTKPQIVHALGSVANVSTSQASNMESSDRLPPSVS
ISSFVRCSNRTTDVKPRISDDIDNNRNWKLAEILDSSQLKALQLPESKVAGKVLRLIYTN
SGQAVLALASNAVHKLWKWQRAERNSSGKSTATIVPQLWQPANGILMKNDTDEASADEES
SACIALSKNDSYVMSASGGKVSLFNMTTFKVMTTFMPPPPAATVLAFHPQDNNIIAIGMD
DSSIQIYNVRVDEVKTKLKGHQKRITGLAFSQALNVLVSSGADAQLCVWSIDGWEKRKAR
ILQTPGGRPGALVGETKVQFHNDQTHILVVHESQIAVYDSKLECTFSHYYVLGLSLVFCL
S
Download sequence
Identical sequences A0A2G5ESX1
Aquca_005_00636.3|PACid:22024040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]