SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_006_00031.5|PACid:22036295 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_006_00031.5|PACid:22036295
Domain Number 1 Region: 16-76,114-337,534-580,776-846
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.55e-19
Family Quinoprotein alcohol dehydrogenase-like 0.031
Further Details:      
 
Domain Number 2 Region: 416-449,535-655
Classification Level Classification E-value
Superfamily TolB, C-terminal domain 0.0000209
Family TolB, C-terminal domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_006_00031.5|PACid:22036295
Sequence length 898
Sequence
MSTVPRLAQETWDCMLPGPPSRNNGGSIDCSTSGLLAYGAGSSVSIIDTRSMQLVTVLPM
PAPSGNSSSSSSLSSSSSSSSSSLLAPFVTCVRWTPQSLRRDILTHEPSNSHLILAVGDR
QGRIALFDFRLKHVLLWMDFDPPSNSKLGVQDLCWIRVKTDSWILASINGPSLLSLWNTF
NGRCIWKYDSSPEYFSCIRRDPFDFRHFCVLGLKGFLLSVKLVGDGEDDVVIKEHQIPIN
ESNELLKLERESALNPSTPALAAFPHYIVKFCFSSQWKHILYVTFPKELLVFDLQYETSL
SSTALPRSCSKFIDVTPDPDSELLYCAHLDGKLSTWRRKEEEQVYTMCTMEELMPSIGTS
VPSPTFLAFVLCQSESTLRSVRNLYPDMSPTSAISMDYSNPSDSSGESLVVSKINIISVS
DDGKLWCWFLTAEGARDRSSLSSNTTVSETTFADTKSSTKDVSIDGPVLDASKESEPINV
ISSRLLSTTSPNVKLSFKISLIGQLQLLSSTVTVLAVPSPSLTATLARGGNNPAVAVPLV
ALGTQGGTIDVIDVSANAVAASFSVHNTIIRGLRWLGNSRLVSFSYSQANEKAGGYINKL
VVTCVRSGLNRKFRVLQKPERAPIRALRASSSGRYVLILFRDAPVEVWAMTKNPIMLRSL
ALPFTVLEWTLPTVPRPSQNVSSSRQSSFSSKEHTTLTPASVVSSTSASTEDSKATNSEG
STDDTSESFAFALVNGALGVFEVHGRRIRDFRPKWPSSSFVSSDGLVTAMAYRLPHVVMG
DRSGNIRWWDVTTGVSSSFNTHREGIRRIKFSPVVAGDRSRGRIAVLFYDNTFSLFDLDS
QDPLANSLLQPQLPGTLVLELDWLPLRTDKDEPLVLCIAGADSSFRLIEVNMYVSRFS
Download sequence
Identical sequences A0A2G5EMM2
Aquca_006_00031.5|PACid:22036295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]