SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_006_00043.3|PACid:22036394 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_006_00043.3|PACid:22036394
Domain Number 1 Region: 436-498
Classification Level Classification E-value
Superfamily FF domain 5.36e-17
Family FF domain 0.00039
Further Details:      
 
Domain Number 2 Region: 503-573
Classification Level Classification E-value
Superfamily FF domain 3.79e-16
Family FF domain 0.001
Further Details:      
 
Domain Number 3 Region: 200-234
Classification Level Classification E-value
Superfamily WW domain 0.00000000011
Family WW domain 0.0012
Further Details:      
 
Domain Number 4 Region: 787-848
Classification Level Classification E-value
Superfamily FF domain 0.000000000288
Family FF domain 0.0033
Further Details:      
 
Domain Number 5 Region: 646-721
Classification Level Classification E-value
Superfamily FF domain 0.000000000392
Family FF domain 0.0035
Further Details:      
 
Domain Number 6 Region: 229-270
Classification Level Classification E-value
Superfamily WW domain 0.000000000653
Family WW domain 0.0018
Further Details:      
 
Domain Number 7 Region: 571-640
Classification Level Classification E-value
Superfamily FF domain 0.0000000017
Family FF domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_006_00043.3|PACid:22036394
Sequence length 962
Sequence
MSSNPQSSGTQVPRPPLVGSVGSQNFMQFQPGAAQQQQQQQTQSFIPAGSQQFRPVAQGQ
QMHFSQTMQQVPLRPPSSQAFSMSYGQPNMPVAAASTQPQHSTQGVGGFGMAPSSSYTFT
PSPYGQPPNSINMSAQYQPSSQMNASVIPVGGQPWLSSGSQSIPVATHMEQPTGQQPSVM
VSTISAAHAQTNPSIPSSSDWQEHTAADGRRYYYNKKTRQSSWEKPVELMTPLERADAST
VWKEFATQDGRKYYYNKDTKESKWTIPEELKLAREQAEKMSSQGTHTDTAVASQAHVSVN
VSTVEVSSNSASAMSGVISSPVSVTPVVPAANSLPLVALGSQSTPISTSSVSLNFVGGHS
PVASITPSHASVTGTGIPADLATSATLMNVSDNVHSQDVPNSANGASIQDLEEAKKGMTV
AGKVNVTIQEDKTVDDEPFPYPSKQEAKNAFKALLESANVESDWSWDQAMRIIVNDKRYG
ALKTLGEKKQAFNEYLGQRKKQEAEERRIKQKKAREEFTKMLEESKELTSSTRWSKAISM
FEEDERFKAVERPRDREDLFESYIVELQKKEREKAQEEHQENLMEYRRFLESCGFIKVDS
LWRKVQDRLEDDERCSRLEKIDRLEGFKEYIRDLEKEEDEQKKIHKEKVRRTERKNRDDF
LKLMEEDVATGVLTAKTHWRDYCIKVKETPEYMAVALNTSGSTPKDLFEDVVEDLEKQYH
DDKYRIKDSIKLKKITLTSTWTLEDLQDAISDEVSSPQISNINFKLVYDELLERIKEKEE
KEAKKRQRLADDFTDLLYSIKEITASSIWEDSRQYFEDSQEYRSIGEESLKREIFEEYIS
LLLEKAKEKELKREEEKKEKEKEEKEKKKEKEKEKERKEKEKEREREKGKERSKKDENED
DSVDVTDVKEEKRKEKDRDRKHRKRHQSAADDLSSEKDEKEDSKKSRRHSSDRRKSRKVA
IY
Download sequence
Identical sequences A0A2G5EMS0
Aquca_006_00043.3|PACid:22036394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]