SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_006_00135.1|PACid:22036695 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_006_00135.1|PACid:22036695
Domain Number 1 Region: 2-202
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.68e-31
Family Quinoprotein alcohol dehydrogenase-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_006_00135.1|PACid:22036695
Sequence length 230
Sequence
MAFDLDNGSIKWYRQLGGYDVWFRACNDVTTPGCAPGPNPDADFGEAPMMLITNVNGTQM
DIVAIVQKSGYAWALDCNNGHIIWSTVAGPGGTGGGGTWGAATDGRRVYTNIANSLHTNF
TLAPSKLITTAGAWVAMEASTGKILWSMANPRNSTASGPVTVANNVVFAGSDDPKGALYA
MDARTGTILWSYDTGAAVHGGVSVSDGCIYVGNGYAKLTPGTSLYAFCIS
Download sequence
Identical sequences A0A2G5ENC6
Aquca_006_00135.1|PACid:22036695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]