SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_006_00175.1|PACid:22036437 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_006_00175.1|PACid:22036437
Domain Number 1 Region: 1228-1499
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.68e-29
Family WD40-repeat 0.0023
Further Details:      
 
Domain Number 2 Region: 520-593
Classification Level Classification E-value
Superfamily RING/U-box 7.85e-23
Family U-box 0.0018
Further Details:      
 
Domain Number 3 Region: 662-1041,1073-1179
Classification Level Classification E-value
Superfamily ARM repeat 0.00000112
Family Armadillo repeat 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_006_00175.1|PACid:22036437
Sequence length 1499
Sequence
MAGHYKFSMDQKDILRSLIAAVGSFIQDRLINKEQRLLHKEQCAERLAAEDGSCCRDSEV
GYSDQAVLANLDWGIDALEEAINTSNVETKLARLDYAEKMLQVCAMLNSRQKTAGVPNFY
LSAWSHLYLAFLWNLRNNVRNSVLHVLEMFIIDPFFSRIDFAPELWKTMFLPHMSSIIGW
YSESRHRLVMEVIPDSADLSFTADFDQFFNESIILSMRPDQAEKLQTLEQLYGRSLDEYT
KLYAKYYKDCMNSDTTPSKRMAPMLPIAEPPMTPLHEVSRSIPDYVKFGPILPKSAGFSP
FLKEKEECRLNTTLSTLEELEDKWSPKDHSLEENDCDYGSEDGELDMDSEVKTIAVLPNN
LRIDDIGTRTKVMKSKNEWTHSSPLFSPISSPKTPSKFSTPSPSLNSKSDPEPLLRLLSS
RITNVTISTPVPGTPLLLHDACISPAGSDGELREVKKSYIKGSSFGRNTSFGNHTQKYEN
RSVIKTHISDVLQVQFLNFSAEGCQSSNSIPSSGKLTPLNRPPKDFVCPITGQLLTDPVT
LETGQTYERKAIQEWLKRGNTTCPNTRQPLSANALPKTNYVLKRLITSWKDQYPDIAQEF
SYSDTPRVSISSTSSRDPQVESSPSMTYSRPIRETVDQCIKKKNNRYLHAAVSTSPTSVI
SQAAAEEIINGIKPYTLCLCTSEDLQECENAVLKIATTWKDSKGDSGLHSYLSKPTIVNG
FAEILVASVNREVLMKSIYILSDLLIADETVGETLTSVDSYFDCLTVLLKNGLTEAVVLI
YQLRPAYSQLSVRDLIPSLVQVILNKTEDLDDFQFVMDPKDAAVALLEQLLIGGDEGSRS
LTAQSVISANGLSYLIKCLNRFEGRRSIVSILLCCMRADRNSRSFIANHVQLAPVLELFH
ACDDTVRGICIDFFSELVSLNRRTFCNQILQIIKDEGGFSTMHTFLVYLQMAPMEQQPAI
ASLLLQLDLLVEPRKMSIYREEAIETLIEVLRRKDFPISQLMALDELASVSGRLTASGKS
LIEARLLQTAGLDQSYKAFMKTERLVQNNDSLETTDEEEKAAQTWENRVAFVLCNHENGS
IFKALEECLKSNSLKMAKSCLVIATWLTHMLSSLPDTGVRDMARHCLLEQFINVLQSSRN
LEEKALASVALRSFIGDKAALKELGVYAKSVCKSLRKLKRSSVLVTDILKALMNLSSINA
IELWSCAEVTEIDSGSNGEVLSLVHLKDRVFSSHSDGTIKVWDAGKRVLRLIQEAREHAK
SVTCLSVPPSGDKLYSGSLDKTIRIWAIKSEEIHCIQVHDVKEAVHELTANNSFACFASQ
ATGVKIYNWSGVPKHVTFNKYVKCLAMTDRKLYCGCTGYSIQEVDLSKCTSSTFFSGTKK
LLGKQIIHALCIRDGFLFAGGSLVDGIAGRVFSLSTGAVNGALPAGHDIHCIAVNNDFVF
TGSKCGTIDVCLRERLVRVGSLRISGAGNTRVTSLISDLDGDMLFAGSSDSKIKAWTLD
Download sequence
Identical sequences A0A2G5ENB5
Aquca_006_00175.1|PACid:22036437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]