SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_006_00178.1|PACid:22036413 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_006_00178.1|PACid:22036413
Domain Number - Region: 182-261
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.068
Family Myosin rod fragments 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_006_00178.1|PACid:22036413
Sequence length 345
Sequence
MAEEVDESVELLSSRSPSASSQANITGKQEMDQYQSLANLQEKLVEVRTCIQSSERNAKD
FEVLRQRVKDTATLLTYLKSKAKLMPIPQLVHTLNGIRHQEGVGQGGINCTLFTNQSNDT
TLSVPDCPRVETLFETNTRHESLDENDGGLIGDILKSIHMINDLLEVLVKMVIMAETEVS
IEKEKVTLGQEEIKRKVLQIESMSAKVEEMERFALSTNSLLNEMQQKVEDMVLETSRQRQ
RAAENEQELYRVKQDFESLRSYVSSLISVREMLLSSEKHQTNEMQFERLVALAAQLEGEK
VKKEAEVQKLMYENVKLASLLDKKEAQLLAMNEQCKVMALNSYGT
Download sequence
Identical sequences A0A2G5ENF4
Aquca_006_00178.1|PACid:22036413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]