SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_006_00362.1|PACid:22036937 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_006_00362.1|PACid:22036937
Domain Number 1 Region: 23-307
Classification Level Classification E-value
Superfamily WD40 repeat-like 3e-55
Family WD40-repeat 0.0014
Further Details:      
 
Weak hits

Sequence:  Aquca_006_00362.1|PACid:22036937
Domain Number - Region: 347-421
Classification Level Classification E-value
Superfamily MW0975(SA0943)-like 0.0275
Family MW0975(SA0943)-like 0.035
Further Details:      
 
Domain Number - Region: 554-690
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0667
Family DPP6 N-terminal domain-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_006_00362.1|PACid:22036937
Sequence length 980
Sequence
MKGRSLKLKEAHKNTNGLPSFCSILWDLDAEHLVTSSSSDSSISIHDFINTSISPKIVRH
HKDGVTAIALSPNSTCLASGSIDHSVKLYRFPGGEFQTNITRFTLPIRALAFNKSGSMLG
AAGDDEGIKLINTIDGSIARVLKGHKGSVVSLAFDPIGEYLASVDSIGTVMFWELGSGKV
LNTLKGVAPDTGSDMSALSVLSWSPDGNVLAVPGLKGDVVIYDRDTAEKIFSLKGEHEKV
VCFVSWSPNGKYMATSGLDKQVLIWDVDQRQDIDRQKLDHRISCMAWKPNGNALAVIDVM
GKYGVWESPVPSSMKSPTDGASLKSKSSGLLLFDDDDDGEDDDQEPSNLGNMSDVDEDSF
GESELVSRKRLRKQSDYDNMFDEDSDDQKRHLPKVEPRKKVSRSNKESLDDANEKIQSAV
KSERSKMQEAFQPGCTPVQSGKRRFLCYNMLGSITTIENDGCSHIEVDFHDTGRGPRVPS
MTDYFGFTMASLNESGSVFANPCKGEKNKNMSTLMYRPFSSWANNSEWSMRFEAEEVKAV
AIGAGWIAAVTSLNILRIFTEGGLQRHILSLDGRVVTAAGFRDELVVVTHASHPLPSNDQ
MLEFRVFNISNGTQPLRGRLALTPGSFLSWFGFSEDGQLSSYDSEGMLRVFTNQYGGSWI
PVFSASKEKKLDESYWMVGLNSSKVFCIACKSPDIYPAVTPKPVLTLLSLSFPLASSDLG
ADNLENEFLLNNLYLLQAQKKIEELTAAGLDTTAQDDEVFTLEASLDRNILRLINACCNA
DKLVRATELVRLLSMEKSMKGAIKLVTALKLPSLAERFSGILEERMLKEAMEAATLPATS
DGALGNGFEVQEQTKLSENKASEPEVASSPPKFSSPQFTRQGKALEKNKVDVKKIEPNRT
RAEGTLKDEANREQPHRPSNPFSKPLNSQHNLSNKNLNEVDIKEGGASQSQSHRPANPFV
KAPGTQKPSLFDSIKKKGNQ
Download sequence
Identical sequences A0A2G5EPE1
Aquca_006_00362.1|PACid:22036937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]