SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_006_00414.1|PACid:22036512 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_006_00414.1|PACid:22036512
Domain Number 1 Region: 995-1132,1237-1298
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000481
Family Cell cycle arrest protein BUB3 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_006_00414.1|PACid:22036512
Sequence length 1301
Sequence
MKEVEEERSDGLEIISIGSIYKGFSWNKKYWSSSRGKDRYPYPIGYHAVRTHNGITYKME
ICEGLKGPLFVITSTDGESCSGQTPDITWDSFQKKSAPRAKLGQGKRFSCKIDGVEFFGF
RNALVQRLLRDLVSNVDGRADRNLSSSGFCNEARMLEPDTQSPESCKRLDLLSNVIKSQN
IRKRSRKDKIAAIDTASGPELRRLQAQDVSDNLEYSITEKDNQSHHNGERCFTILNEDCK
VENSPKSFSADVENELLERGNNSPLVNNDSALDPWKIADPIEMDADLLPKHQFIGSGDSR
FISSILNLSKQEEHIDTSVDAYTQGCESLEETKDAIGERMSEESKTVKNLDLCVPDSLDV
LQDKVSDSAPNCKKTDLCQAIEDELAASVLIHSRETMRSLHGEDEVGMYISNGSSQKSSD
DSVGEDLAKSMMTLLLPQALPLLKKGSGRKRKKVHLSEISIYNGDGCPNLDAMKLSEEGD
GLYHAANTSPGTLEVGTMVKESSRNMEGQTHCLNKTHLEGAKSIVPDSFEDEQFGSHTSY
QNSFCPDSNEVDDKDPGPTKNVPSSEPTFVAQNETEPSQSKGFARNLEMVASTSEPDNVK
EVHTPNSTKNIGNMSNGSSNEKLIQYSRRRRSTSKKDQNSSSHENKDSVVTKQMSATREA
IGVNSKLSQSSVHMSEKEVDIIETRDTKNSNISSIQKSGLPPSKRFRGPVSESIIYRNNT
DSCHPDADNLFATEFDQVGASVDSLYKKVSIGGEVLLDQKNNNCSMESGTVRLNGMHSQA
QAVVDHSAKNKDHIDGKIHQDDIITDGTGSLLFQEIKKSFSFDDHLRDTKENFGEPDMQP
QFKSVTGSGQNDGHLFFDHELHEEHLLTNHQFLLNTEDNYTSKDFVELVGCYVQPAPILS
VVLSSQGDDVHISVLCGILADRLRTIFVYKVSLKEPSRGSPSFLGYTPLMLPISKYTFSG
EIAFEKFPVQFTPDGQGLVISNSIKAPYCRGRSIHCVCSVCNSACSEENAVKIIHVKLGY
VSLAAKLKTEDNVHSILVCEPSHLIALEKNGRVIVWSMNSMWNEKVEEFILPSLTHMSPC
TLELKKIPKHPSVIVGHNGFGNFCLWDISKGTIISTFSAPRNCIFQFLPVGLFGWKRPAS
ADIYVEEQIKGIMSATKRWFSGTSVDVDFLSFDDEDIAVWLLVSAVWDSEVRFDHKSNGI
NTSANGSWRLALLVDNRVILGKPLDPRASVINVLEGCGIIGSHDGLVYIWELSTGLKLAD
LHHFNSGRVSCITSDSKSGVLAVAGDENQLLVYAIPQPTEE
Download sequence
Identical sequences A0A2G5EPM4
Aquca_006_00414.1|PACid:22036512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]