SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_006_00416.1|PACid:22036696 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_006_00416.1|PACid:22036696
Domain Number 1 Region: 4-235
Classification Level Classification E-value
Superfamily 14-3-3 protein 1.1e-107
Family 14-3-3 protein 0.0000000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_006_00416.1|PACid:22036696
Sequence length 270
Sequence
MEKERENHVYLAKLAEQAERYDEMVESMKKVATLDLELTVEERNLLSVGYKNVIGARRAS
WRIMSSIEQKEESKGNDQNVKMIKNYRQKVEEELSKICNDILTIIDKHLIPSSTTGESTV
FYHKMKGDYYRYLAEFKTDQERKDAADQSLESYQAASNIANTDLPSTHPIRLGLALNFSV
FYYEILNSPERACHLAKQAFDEAIAELDTLSEDSYKDSTLIMQLLRDNLTLWTSDLPEDG
AEDGFKAEESKAAETKATETKAAEPEVKAS
Download sequence
Identical sequences A0A2G5EPI3
Aquca_006_00416.1|PACid:22036696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]