SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_006_00470.2|PACid:22036726 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_006_00470.2|PACid:22036726
Domain Number 1 Region: 62-257,318-353
Classification Level Classification E-value
Superfamily Pseudouridine synthase 4.89e-59
Family Pseudouridine synthase I TruA 0.0000547
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_006_00470.2|PACid:22036726
Sequence length 376
Sequence
MQTSSSSSSSSYTSNGEHSKRCISSLLESSCLEKPLKIPKTKEEEEEEEEEEELMSEKNP
RIQRYLIAIEYIGTRFSGSQKQKAECRTVVGVLEEAFHKFIGQPVSVSCSSRTDAGVHAL
SNVCHVDVERISKRKPGEVLPAHEPGVVRKAVNHFLQKNEGDITVIDVRCVPSDFHARFK
AQERTYFYRLISGPEPLSTFEKDRAWHVSEELDLASMQKACRILVGHHDFSSFRASGCQA
KSPIRTLDELNVSELASTPYFPSIVERQNSILEQDLLNSSCLSENELSLKSSIPNPYSVT
GSSNSSNKGFGQLRSHRCFVVTARARSFLYHQVRLLVGLLKCVGTGNLKTDDGVFHFPTL
HVSVFVYGCLCRNKIK
Download sequence
Identical sequences A0A2G5EPS6
Aquca_006_00470.2|PACid:22036726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]