SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_006_00471.1|PACid:22036669 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_006_00471.1|PACid:22036669
Domain Number 1 Region: 12-294
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.37e-31
Family Cell cycle arrest protein BUB3 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_006_00471.1|PACid:22036669
Sequence length 328
Sequence
MDGICLKFENPIRDAISKIRFAPQSNNLLISSWDSMLRLYDVESSIMRLETTSGAALIGC
CFQNESTAFSIGADFCVRRYNFDVGSCNTFGHHDDLATCIEYSEETSQVMSATLDKKICS
WDLRKENGVGCTKYVGGEVESMSTCGFYLLVAIGTSVSIYDLRKLDEPVQMKETSVDYRI
KSVCSFPNRRGYAVGSIDGRAALEFINPSDASEKSYHFRCNPKSKDGKDHLIAVNDIVFH
PSFYGAFVTGDNDGYAIMWDAQSKKRLYQFPRYISSVASLSYNCGGELLAVASSYTCQEA
NEIEEPPHIFIHRMDEISVGSSSIQRSK
Download sequence
Identical sequences A0A2G5EPT1
Aquca_006_00471.1|PACid:22036669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]