SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_007_00051.1|PACid:22047686 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_007_00051.1|PACid:22047686
Domain Number 1 Region: 3-47
Classification Level Classification E-value
Superfamily F-box domain 0.000017
Family F-box domain 0.0067
Further Details:      
 
Domain Number 2 Region: 176-334
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000314
Family Quinoprotein alcohol dehydrogenase-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_007_00051.1|PACid:22047686
Sequence length 348
Sequence
EINWLDLPDHILSLIADLLNREKDLIHFGAVCHPWQSVCIDTLTRRRSHRLPLLMFATEY
YQDDQTRSFYNLTDSTVYDAQVQVPHNMHCPGSSHGWLFTVCPKTFKVPFLSSNNEITLP
PLTAFQHGFVGDNILENFYVGFLEKAVLSSNPASDPNYVIMAINNGSYKLAFYKPGDNVW
TSLDSRFVRIVDIIYYRDRFYVINREGQVFSFDFNHEEAPKVSTIALHPPEGVRADQRYL
VESSGYLLQLDPIEQKWVELDNLGGRILFLGHNTSLSVSASDFPECKPNSIYFTDDYYDG
YYEESGFGGHDMGVYDLKNRTIEWHYPTEAKWIYPPPVWIERPLRWNL
Download sequence
Identical sequences A0A2G5EIS4
Aquca_007_00051.1|PACid:22047686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]